DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crisp3

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:44/259 - (16%)
Similarity:88/259 - (33%) Gaps:79/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DAHIVRITTARRTM---ILNELNEYRDRIARGDLMGFSPA-TRMATLQWDQELASFAELNVKRCA 113
            |..:..::|.:.::   |:|:.|:.|..:        ||: :.:..::||.:....|:....|| 
  Rat    27 DRDLENLSTTKLSVQEEIINKHNQLRRTV--------SPSGSDLLRVEWDHDAYVNAQKWANRC- 82

  Fly   114 LVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAE 178
             :.:|  :..|.|.......|..:..:                           ..|:...:..:
  Rat    83 -IYNH--SPLQHRTTTLKCGENLFMAN---------------------------YPASWSSVIQD 117

  Fly   179 YKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVH 243
            :.:.|:..:..|.|.       :|...:.::||:|.:||..|.||:          |......:.
  Rat   118 WYDESLDFVFGFGPK-------KVGVKVGHYTQVVWNSTFLVACGV----------AECPDQPLK 165

  Fly   244 QYMTCNFVRTNDVNAPVYQSGDRPATE----------CRSGRNPVFINLCSVNEIYDSSNLAGL 297
            .:..|::....:....:|.    |.||          |..|   :..|.|...:.|  ||...|
  Rat   166 YFYVCHYCPGGNYVGRLYS----PYTEGEPCDSCPGNCEDG---LCTNSCEYEDNY--SNCGDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 30/189 (16%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 30/190 (16%)
Crisp 192..246 CDD:285731 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344818
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.