DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and pi15a

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:281 Identity:59/281 - (20%)
Similarity:99/281 - (35%) Gaps:99/281 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LADI-CSPDAHI---VRITTARRTMILNE-----LNEYRDRIARGDLMGFSPATRMATLQWDQEL 101
            |.|| .:|..::   ..|...||...:::     :.:|.::: ||.:  |.||:.|..:.||..|
Zfish    38 LTDIGFAPPKYLTEAANIPKTRRKRYISQNDMLAILDYHNKV-RGKV--FPPASNMEYMVWDDTL 99

  Fly   102 ASFAELNVKRCALVNDH-CRN------------SEQFRNVAQVVAEGGWQGD------PLPPSSP 147
            |..||.....|  :.:| .||            :.::|::.|:|..  |..:      |.|... 
Zfish   100 AKTAEQWASTC--IWEHGPRNLLRFLGQNLSVRTGRYRSILQLVKP--WHDEVKDYSFPYPRDC- 159

  Fly   148 SDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKC----IAY 208
                ||..|:                                              ||    ..:
Zfish   160 ----NPRCPL----------------------------------------------KCYGPMCTH 174

  Fly   209 FTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF-VRTNDVNAPVYQSGDRPATECR 272
            :||:|..::..|||.|  .|.:..|..| |:.....|:.||: .:.|.:....|:.| .|.:.| 
Zfish   175 YTQMVWATSNKVGCAI--NTCHNMNVWG-SVWKRATYLVCNYSPKGNWIGEAPYKVG-VPCSMC- 234

  Fly   273 SGRNPVFINLCSVNEIYDSSN 293
               .|.:...||.|..:.:.|
Zfish   235 ---PPSYGGSCSNNMCFPAVN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 42/213 (20%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 42/203 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.