DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and pi15b

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:254 Identity:54/254 - (21%)
Similarity:83/254 - (32%) Gaps:100/254 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCA-----------LVNDHCR 120
            ||:..|:.|..:       |.||..|..:.||..||..||.....|.           |..:...
Zfish    69 ILDYHNKVRANV-------FPPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRYLGQNLSV 126

  Fly   121 NSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECS-- 183
            .:..:|::.|:|..  |.                          |||    .:.||...::|:  
Zfish   127 RTGNYRSILQLVKP--WY--------------------------DEV----RDYMFPYPRDCNPH 159

  Fly   184 --MRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQT-----------KNTTNEA 235
              ||   .:.|           .| .::||:|..|:..|||.|  ||           :..|   
Zfish   160 CPMR---CYGP-----------MC-THYTQMVWASSNRVGCAI--QTCFNMVVWGAVWREAT--- 204

  Fly   236 GQSLSSVHQYMTCNF-VRTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVNEIYDSSN 293
                     |:.||: .:.|.:....|:.| .|.:.|    .|.:...||.|..:.:.|
Zfish   205 ---------YLVCNYSPKGNWIGEAPYRVG-VPCSAC----PPSYGGSCSNNMCFPAIN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 43/208 (21%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 44/209 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.