DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and PI15

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:314 Identity:72/314 - (22%)
Similarity:109/314 - (34%) Gaps:119/314 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLMLLGQQ-----LQAFDYCDPTLCPGPERHIACNNF----GAL-ADICSPDAHIVRITTARRT 65
            ||..||.:.     |.:.|...||           |||    .|| |.:.|.|     |..|||.
Human    11 LLFSLLCEASTVVLLNSTDSSPPT-----------NNFTDIEAALKAQLDSAD-----IPKARRK 59

  Fly    66 MILNE-----LNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDH------- 118
            ..:::     :.:|.::: ||.:  |.||..|..:.||:.||..||.....|  :.||       
Human    60 RYISQNDMIAILDYHNQV-RGKV--FPPAANMEYMVWDENLAKSAEAWAATC--IWDHGPSYLLR 119

  Fly   119 ------CRNSEQFRNVAQVVAEGGWQGD------PLPPSSPSDPPNPEAPIPVEYHTEDEVIKAT 171
                  ...:.::|::.|:|..  |..:      |.|...     ||                  
Human   120 FLGQNLSVRTGRYRSILQLVKP--WYDEVKDYAFPYPQDC-----NP------------------ 159

  Fly   172 LEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAG 236
                     .|.||   .|.|           .| .::||:|..::..:||.|  .|....|..|
Human   160 ---------RCPMR---CFGP-----------MC-THYTQMVWATSNRIGCAI--HTCQNMNVWG 198

  Fly   237 QSLSSVHQ---YMTCNFV-RTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVN 286
                ||.:   |:.||:. :.|.:....|:.| .|.:.|    .|.:...|:.|
Human   199 ----SVWRRAVYLVCNYAPKGNWIGEAPYKVG-VPCSSC----PPSYGGSCTDN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 44/212 (21%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 44/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.