DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:223 Identity:46/223 - (20%)
Similarity:76/223 - (34%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRN-----SEQFRN 127
            ||..||.|.::.       .||:.|..|.||:.||..|:...:.|...::.|.:     ::.:..
  Rat    46 LNSHNEARRKVQ-------PPASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYDY 103

  Fly   128 VAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSP 192
            :.:.:..|                      .::...||.|.     ..:.|.|:.:..|...   
  Rat   104 IGENIYLG----------------------KIDARPEDVVF-----SWYNETKDYNFDDNTC--- 138

  Fly   193 PNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRT-NDV 256
                      :|...::||:|...|..:||.|......|...||        ...||:|.. |..
  Rat   139 ----------TKTCGHYTQVVWAKTLKIGCAISNCPHLTGYSAG--------LFVCNYVPAGNFQ 185

  Fly   257 NAPVYQSGDRPATECRSGRNPVFINLCS 284
            .:..|..|: |.:.|  |......:|||
  Rat   186 GSKPYIKGE-PCSMC--GEKECVNSLCS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 35/186 (19%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 37/189 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.