DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and crisp1.3

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:300 Identity:57/300 - (19%)
Similarity:100/300 - (33%) Gaps:110/300 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRT---MILNELNEY 74
            :||:|           .||      ||.  |.||| :.|.|.....|:|...|   :|:|..|.|
 Frog     1 MMLIG-----------ALC------IAA--FMALA-VESADPPFSSISTDNVTVTQIIINAHNNY 45

  Fly    75 RDRIARGDLMGFSPATR-MATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQ 138
            |        ...||:.| |..:.|:::.|                             :....|.
 Frog    46 R--------RNASPSARNMLKMVWNKDAA-----------------------------INAASWA 73

  Fly   139 GDPLPPSSPSDPPNPEAPIP----------VEYHTE-DEVIKATLEQMFAEYKECSMRDIIAFSP 192
            .......||||    :..||          ..|... :|.:|.    .::||.:..    ....|
 Frog    74 ATCSESHSPSD----KRTIPGFGCGENLYMASYPASWEEAVKG----WYSEYNDFQ----YGVGP 126

  Fly   193 PNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVN 257
            .:..::       ..::||::..::..|||.:....|          |....:..|.:....:::
 Frog   127 KSPGLV-------TGHYTQVMWYNSYMVGCSVSYCPK----------SPYKYFYVCQYCPAGNLD 174

  Fly   258 APV---YQSGDRPA---TECRSGRNPVFINLCSVNEIYDS 291
            :.:   |::|.:.|   |.|.:|   :..|.|...::|.:
 Frog   175 STMSTPYKTGPKCADCPTACDNG---LCTNYCPYQDLYSN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 33/200 (17%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 33/202 (16%)
Crisp 187..240 CDD:369954 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.