DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Ag5r

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:283 Identity:85/283 - (30%)
Similarity:129/283 - (45%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLMGF 86
            |.|||..: | |..:::.|:|.||.|..|..||.::.:::|.:..::...||||:.||.|.....
  Fly    19 ATDYCKKS-C-GSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVARTNEYRNHIAGGLNANL 81

  Fly    87 SPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPP 151
            |.|.||||::|:.|||..|.||||.|.:.:|.|.|::.|          .|.|..|......:|.
  Fly    82 SAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAF----------DWSGQNLAWMGYYNPL 136

  Fly   152 NPEAPIPVEYHTE-------DEVI---KATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCI 206
            |      |.::.|       ||.:   :|.::...:.|.                      ...|
  Fly   137 N------VTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN----------------------GPAI 173

  Fly   207 AYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRPATEC 271
            .:||.||.|..|.|||...     |.:.:|||..:.  .:.||:..||.:...:|.|..:.|::|
  Fly   174 GHFTVLVADRNTEVGCAAA-----TYSVSGQSYKAF--LLACNYAATNVLGIKMYSSCSKAASKC 231

  Fly   272 RSGRNPVFINLCSVNEIYDSSNL 294
            .:|.||.:..|||..|.|:.:||
  Fly   232 TTGTNPKYKYLCSAKEEYNVNNL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 53/195 (27%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 54/196 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440588
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.