DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and scpr-C

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:291 Identity:102/291 - (35%)
Similarity:139/291 - (47%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNE 73
            |:||..|||..|.| |||....|  .::||||||.|..::.|..|...|:|....: :|||..||
  Fly     6 LILLTSLLGISLAA-DYCALPTC--LDKHIACNNKGNFSENCPKDVREVKIEPHHK-LILNLFNE 66

  Fly    74 YRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQ 138
            .|:.:|.|.:.|...|.|||.:.|.:||:..|.||||.|..:.|.||::|:|....|..|...:.
  Fly    67 LRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYS 131

  Fly   139 GDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSP---PNNRILRL 200
            |                 ...|| |:.|:||..:|..|||....| .:|:|..|   ||      
  Fly   132 G-----------------AETEY-TDAEIIKEQIENWFAERSNAS-PEILASFPEELPN------ 171

  Fly   201 RVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGD 265
               |.:..||..|.:..|||||..:|.:::..|         |..:||||..:|.|..|||..|:
  Fly   172 ---KAVTKFTIAVAEKNTHVGCAAVRFSRDFYN---------HFVLTCNFATSNIVGQPVYTPGE 224

  Fly   266 RPATEC--RSGRNPVFINLCSVNEIYDSSNL 294
            :..|.|  |.|....:.|||...||||:..:
  Fly   225 KATTGCKNRYGAAYDYPNLCYAKEIYDNEKV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 60/188 (32%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 61/189 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440584
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.