DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CG31482

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster


Alignment Length:162 Identity:34/162 - (20%)
Similarity:52/162 - (32%) Gaps:54/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVV 132
            |||.|..|::      .|..|.|      .|.||....|...|..|       |:|:..:.:   
  Fly    27 LNEHNRLREK------HGSPPLT------LDDELTKGCEEYAKVLA-------NNEKLEHSS--- 69

  Fly   133 AEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRI 197
            :.|...|:.|...|       :.|:.......||:         |:|.         |..|    
  Fly    70 SAGQNYGENLCMRS-------QTPLQCVQDWYDEI---------ADYD---------FEKP---- 105

  Fly   198 LRLRVSKCIAYFTQLVRDSTTHVGCGILRQTK 229
               :.:....:||.||..:...:|.|..:..|
  Fly   106 ---QFAMSTGHFTALVWKNAKKMGIGQAKDKK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 34/162 (21%)
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 34/162 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.