DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CG42564

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:273 Identity:85/273 - (31%)
Similarity:134/273 - (49%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLMGFSP 88
            |||||:||....:|:|||....|.|.||.||.::.|:......:|...||.||.:|:|...|.||
  Fly    54 DYCDPSLCHKELKHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGLSP 118

  Fly    89 ATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNP 153
            |:||.||:|:.|||..||.||:.|.|.:|.|||::..:|..|.|...|.:|           ..|
  Fly   119 ASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGIKG-----------KLP 172

  Fly   154 EAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAF------SPPNNRILRLRVSKCIAYFTQL 212
            |.         :::::..:.....|....||.:|:.:      ||..|             |.|:
  Fly   173 EL---------EDILRDIIGVWLREKSRTSMVNIMKYVEQESQSPKYN-------------FLQI 215

  Fly   213 VRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRPATECRSGRNP 277
            |.::...|||.|::|:::         ..:..:..||:.....|.:|||:.|.:.|..|::|.||
  Fly   216 VLENAESVGCAIVQQSRH---------GWIQTFFACNYGHAPVVGSPVYEPGKKAAESCKTGANP 271

  Fly   278 VFINLCSVNEIYD 290
            .:.:||:.:|:|:
  Fly   272 KYAHLCAESEVYE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 52/191 (27%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440565
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.