DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and crisp1.7

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:233 Identity:49/233 - (21%)
Similarity:80/233 - (34%) Gaps:59/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNV 128
            |..|::..|.|| |.|.      ..|:.|..:.|..|    ||.|.|..|...:...:....|.:
 Frog    34 RQKIVDIHNAYR-RSAN------PTASNMLKMSWSIE----AENNAKNWATTCNQYHSQPAARQI 87

  Fly   129 AQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPP 193
            |.:..     |:.|..||          .|..:   :|||    :.:.:||      |...:.  
 Frog    88 ANITC-----GENLFMSS----------YPASW---EEVI----QSLHSEY------DNFEYG-- 122

  Fly   194 NNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTND--- 255
               :....|...|.::||::...:..:||        ...|.......:..|..|.:....:   
 Frog   123 ---VGAKAVGLVIGHYTQVMWYKSYRIGC--------YCTECPNDGVRLKYYYVCQYYPAGNYAD 176

  Fly   256 -VNAPVYQSGDRPATECRSG-RNPVFINLCSVNEIYDS 291
             :|.| |:||...| :|... .|.:..|.|...:.|.:
 Frog   177 RINYP-YKSGPSCA-DCPDACDNGLCTNPCPYEDQYSN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 38/185 (21%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 38/188 (20%)
Crisp 188..243 CDD:369954 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.