DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and glipr1b

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:230 Identity:48/230 - (20%)
Similarity:80/230 - (34%) Gaps:69/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQ-WDQELA 102
            :|:....|..|..|: .|.|...|.        |.:|.|::.......|...::..:| ||:|||
Zfish    18 SCSVLALLPGITEPE-FIRRCVKAH--------NTHRARVSPPAAGARSMVRQVFGMQSWDKELA 73

  Fly   103 SFAELNVKRCALVNDHCRNSEQ----------FRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPI 157
            ..|....:       ||:.|..          |          ||.|:.:...||..        
Zfish    74 KGARDRAR-------HCKGSHYPSLGHFGHPLF----------GWMGENIWLGSPFS-------- 113

  Fly   158 PVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGC 222
              .:..|:.|.:.:.|.              |:|..||...||    | .::.||:..::..:||
Zfish   114 --AFSVENAVHRWSKEG--------------AYSVKNNNCSRL----C-GHYAQLMWSTSFKMGC 157

  Fly   223 GILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVN 257
            .:...:|...|.:....|::   ..||:..|..|:
Zfish   158 AVNVCSKGIENFSTHPESTI---FVCNYGDTGQVH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 38/196 (19%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 42/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.