DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CG6628

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:299 Identity:93/299 - (31%)
Similarity:132/299 - (44%) Gaps:61/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLMLLGQQLQAF----------DYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTAR 63
            |::.|||.|....||          |||...|||..::||||.|.|.|...||||||:|.: |..
  Fly     5 LVVALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNL-TGL 68

  Fly    64 RTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNV 128
            :.:||.|.|..|:.:|.|.::......|||||||..|||..|.||||:|.|.:|.|.|:..|.|.
  Fly    69 QDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNS 133

  Fly   129 AQVVA--------EGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMR 185
            .|.:|        |.|                        .||::.::|.::...:.:....:..
  Fly   134 GQNLALVNITLLPEDG------------------------NHTDECLVKESIGGWWNQSINITKE 174

  Fly   186 DIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF 250
            .:..|  |..::     ...|..|..:.||:.|||||..||..|    .||..|.    .:.||:
  Fly   175 QLQRF--PKGKL-----GDSIRNFAVMARDNNTHVGCAALRFEK----PAGHPLF----LLACNY 224

  Fly   251 VRTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVNEIY 289
            ......:.|:|:   ..|..|:||.:..:.:||...|.|
  Fly   225 ASNYVPDWPIYK---EKAIGCQSGSDLKYPSLCKAGEEY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 54/193 (28%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 55/194 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440589
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.