DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:206 Identity:40/206 - (19%)
Similarity:64/206 - (31%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LNEYRDRIARGDLMG--FSPATRMATLQWDQELASFAELNVKRCALV-NDHCRNSEQFRNVAQVV 132
            :|||.:  ...:|.|  |.|...:..:.||..|:..|....|:|... |.|.....:...|...:
  Rat    53 INEYVN--LHNELRGTVFPPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPVFTDI 115

  Fly   133 AEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFA---------EYKECSMRDII 188
            .|..|.|                  |.:..|....|::..|:..:         |.::||     
  Rat   116 GENMWVG------------------PEKDFTATNAIRSWHEERKSYNYVNDTCIEDEDCS----- 157

  Fly   189 AFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRT 253
                               ::.|||.|.:..|||.:       |..|.....:......||:...
  Rat   158 -------------------HYIQLVWDHSYKVGCAV-------TPCAKVGAITYAALFICNYAPG 196

  Fly   254 NDVNAPVYQSG 264
            ..:....||:|
  Rat   197 GTLTRRPYQAG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 36/190 (19%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 37/194 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.