DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CLEC18A

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_016878695.1 Gene:CLEC18A / 348174 HGNCID:30388 Length:476 Species:Homo sapiens


Alignment Length:218 Identity:48/218 - (22%)
Similarity:68/218 - (31%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPN 152
            ||..|..|.|...||..|:.....|........ |..:|.: ||    ||....||....|..  
Human    65 PAADMRRLDWSDSLAQLAQARAALCGTPTPSLA-SGLWRTL-QV----GWNMQLLPAGLVSFV-- 121

  Fly   153 PEAPIPVEYHTEDEVIKATLEQMFAEYK-------ECSMRDIIAFSPPNNRILRLRVSKCIAYFT 210
                         ||:..    .|||.:       ||:                 |.:.| .::|
Human   122 -------------EVVSL----WFAEGQRYSHAAGECA-----------------RNATC-THYT 151

  Fly   211 QLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTN-DVNAPV---YQSG------- 264
            |||..:::.:|||      .....|||  :::..::.....|.| :||...   |:.|       
Human   152 QLVWATSSQLGCG------RHLCSAGQ--AAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCT 208

  Fly   265 ----------DRPATECRSGRNP 277
                      |.....|...|||
Human   209 ASVSGCFKAWDHAGGLCEVPRNP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 37/168 (22%)
CLEC18AXP_016878695.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.