DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CG31296

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:271 Identity:68/271 - (25%)
Similarity:117/271 - (43%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLMGF-S 87
            |:|....|  ...::||||....:.:|.|:|..:.::| .|.::|...||:|:..|.|..... :
  Fly    24 DFCQLPYC--GTNNLACNNPSKFSVMCPPNARTLSMST-YRNLLLIAFNEFRNYTASGKQKYLKA 85

  Fly    88 PATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPN 152
            .|.||:.|.:..||...|.|.|..|: .:..|.||::|..|...:....:.|      :.:|..:
  Fly    86 AAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGSTHYLG------NLNDYED 143

  Fly   153 PEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDST 217
            .|..:.:..|.          ..:|:|....|.   .:.|  ..:.:..::|.:.    |:.|..
  Fly   144 LELMLRIIQHW----------TRYADYVNIKMG---VYMP--TTLGKSGIAKALL----LMADRN 189

  Fly   218 THVGCGILRQTKNTTNEAGQSLSSVHQYM-TCNFVRTNDVNAPVYQSGDRPATECRSGRNPVFIN 281
            |||||..:|.|          :.|||.:: .|.|.....|..|:|:...||...|:. .:|.:..
  Fly   190 THVGCSAMRFT----------VHSVHNFVFLCAFSTDLFVERPIYRMSMRPGAACKR-LDPTYSA 243

  Fly   282 LCSVNEIYDSS 292
            ||:|.|.|:::
  Fly   244 LCAVGENYENN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 44/187 (24%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 44/188 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.