DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CG32679

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:299 Identity:91/299 - (30%)
Similarity:136/299 - (45%) Gaps:59/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WPPLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICS-----PDAHIVRITTARRT 65
            |..||.|::::.....|.:||||.|||. .||:||.|.|.....||     .||||        .
  Fly     7 WIFLLYLVLIIFTFTFAQNYCDPELCPS-GRHVACQNSGRFVSGCSGEFVQVDAHI--------P 62

  Fly    66 MILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQ 130
            :||...||.|:.||.|.:.||..|.:|||:.||..||..|..|..:|.:.:|.|||:..:|...|
  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQ 127

  Fly   131 VVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEV---IKATLEQMFAEYKECSMRDIIAFSP 192
                                     .:.:.:....:|   ::..:...|.|.::.:..|:..:  
  Fly   128 -------------------------NLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDY-- 165

  Fly   193 PNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVN 257
                  ::|....|.:||.:|.:....|||.|.|.|.....:|        ..:.||:..||.||
  Fly   166 ------QMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQA--------TLLACNYAVTNVVN 216

  Fly   258 APVYQSGDRPATECRSGRNPVFINLCSVNEIYDSSNLAG 296
            .|||::| ..|:||.:|||..:.||||.||:|:.:..:|
  Fly   217 NPVYRAG-TAASECTTGRNSNYPNLCSPNEVYNYNQWSG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 44/188 (23%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 45/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440581
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.