DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Clec18a

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:238 Identity:55/238 - (23%)
Similarity:80/238 - (33%) Gaps:98/238 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKWPPLLLLLM-LLG---QQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARR 64
            ::|..|||||: |||   .::|      |...|                   ....||:..:.:.
  Rat    35 SRWLGLLLLLLPLLGITWTEVQ------PPQLP-------------------KQVPIVQALSRKE 74

  Fly    65 T-MILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNS------ 122
            : :||...|..|.::       ...|..|..:.|.:.||..|:   .|.||    |..|      
  Rat    75 SFLILTTHNRLRSQV-------HPSAANMQRMDWSESLAQLAQ---ARAAL----CGTSATPNLA 125

  Fly   123 EQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAE---YK---- 180
            ...||...|    ||....||..|.|..               ||:..    .|||   |:    
  Rat   126 ATLRNTPDV----GWNVQLLPMGSASFV---------------EVVNV----WFAEGLQYRHGSA 167

  Fly   181 ECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCG 223
            ||:..                 :.| |::||||..:::.:|||
  Rat   168 ECAHN-----------------ATC-AHYTQLVWATSSQLGCG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 41/174 (24%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 41/171 (24%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.