DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Pi15

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:308 Identity:68/308 - (22%)
Similarity:110/308 - (35%) Gaps:103/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLMLL--GQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNE- 70
            |::||.||  .:.:...::.|.:|        ..|||..:....|.....|.|..|||...::: 
  Rat     9 LVILLSLLCEARTIVLLNFTDSSL--------PANNFSDIEATLSVPVLSVDIPKARRKRYISQN 65

  Fly    71 ----LNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDH------------- 118
                :.:|.::: ||.:  |.||..|..:.||:.||..||.....|  :.||             
  Rat    66 DMIAILDYHNQV-RGKV--FPPAANMEYMVWDENLAKSAEAWAATC--IWDHGPSYLLRFLGQNL 125

  Fly   119 CRNSEQFRNVAQVVAEGGWQGD------PLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFA 177
            ...:.::|::.|:|..  |..:      |.|...     ||                        
  Rat   126 SVRTGRYRSILQLVKP--WYDEVKDYAFPYPQDC-----NP------------------------ 159

  Fly   178 EYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSV 242
               .|.||   .|.|           .| .::||:|..::..:||.|  .|....|..|    ||
  Rat   160 ---RCPMR---CFGP-----------MC-THYTQMVWATSNRIGCAI--HTCQNMNVWG----SV 200

  Fly   243 HQ---YMTCNFV-RTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVN 286
            .:   |:.||:. :.|.:....|:.| .|.:.|    .|.:...|:.|
  Rat   201 WRRAVYLVCNYAPKGNWIGEAPYKVG-VPCSSC----PPSYGGACTDN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 44/212 (21%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 44/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.