DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Glipr1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:156 Identity:27/156 - (17%)
Similarity:52/156 - (33%) Gaps:49/156 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVND---HCRNSEQFRNVAQVVA 133
            |.:|.:       .:.||..|..:.||.:||..|:...:.|...::   |.|....|..:.:.: 
  Rat    42 NHFRSK-------AYPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNFTGLGENI- 98

  Fly   134 EGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRIL 198
               |.|.                  :...:....|.|..|:  ::|.:.|..             
  Rat    99 ---WLGS------------------LSLFSVRAAILAWFEE--SQYYDFSTG------------- 127

  Fly   199 RLRVSKCIAYFTQLVRDSTTHVGCGI 224
              :..|...::||:|...:..:||.:
  Rat   128 --KCKKVCGHYTQIVWADSYKIGCAV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 27/156 (17%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 27/156 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.