DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Pi16

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:288 Identity:70/288 - (24%)
Similarity:106/288 - (36%) Gaps:111/288 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNEL- 71
            ||||||:||  .|.|         .||..        ||.:            ..::||:  || 
  Rat    15 PLLLLLLLL--LLTA---------TGPAT--------ALTE------------DEKQTMV--ELH 46

  Fly    72 NEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFR---NVAQVVA 133
            |.||.:::       .||:.|..::||.|||:||:...::|  |..|  |.|:.|   |:..:..
  Rat    47 NHYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKC--VWGH--NKERGRRGENLFAITD 100

  Fly   134 EGGWQGDPLPPSSPSDPPNPEAPIPV-EYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRI 197
            ||                 .:.|:.| .:|.|.|                              .
  Rat   101 EG-----------------MDVPLAVGNWHEEHE------------------------------Y 118

  Fly   198 LRLRVSKC-----IAYFTQLVRDSTTHVGCGI-LRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDV 256
            ..|..:.|     ..::||:|...|..:|||. ..:|.....||     ::| .:.||:....:|
  Rat   119 YNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEA-----NIH-LLVCNYEPPGNV 177

  Fly   257 NA-PVYQSGDRPATECRSGRNPVFINLC 283
            .. ..||.| .|.::|..|.:.| .:||
  Rat   178 KGRKPYQEG-TPCSQCPLGYSCV-NSLC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 45/196 (23%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.