DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:219 Identity:48/219 - (21%)
Similarity:76/219 - (34%) Gaps:67/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVA--QVVAE 134
            ||:|.::.       .||..|..:.||:.||..|:....:|...::.|.: :.::..|  :.|.|
Human   127 NEWRGKVN-------PPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLD-KSYKCYAAFEYVGE 183

  Fly   135 GGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILR 199
            ..|.|.                  ::..|....|.|.       |.|....|..:.|        
Human   184 NIWLGG------------------IKSFTPRHAITAW-------YNETQFYDFDSLS-------- 215

  Fly   200 LRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF-VRTNDVNAPVYQS 263
              .|:...::||||..::.:|||.:..    ..|..|.|.:    ...||: ...|..|.|.|..
Human   216 --CSRVCGHYTQLVWANSFYVGCAVAM----CPNLGGASTA----IFVCNYGPAGNFANMPPYVR 270

  Fly   264 GDRPATECRSGRNPVFINLCSVNE 287
            |:    .|         :|||..|
Human   271 GE----SC---------SLCSKEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 37/179 (21%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151302
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.