DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and antr

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:292 Identity:67/292 - (22%)
Similarity:129/292 - (44%) Gaps:42/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WPPLLLLLMLLGQQLQAFD-YCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILN 69
            |...|.||.|....:...| :|.|.||...|.|:.|....|:.:.|..:...:.:..|.:|.||:
  Fly     4 WYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILS 68

  Fly    70 ELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVA--QVV 132
            .:|..|:.:|.| :..:|.|.||.|:.||.||...|:..|::|......|.|::::..||  ::.
  Fly    69 RINMLRNYVASG-VGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIR 132

  Fly   133 AEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRI 197
            ::.|....                      .:..::...|.::|.:...|.|.        :.::
  Fly   133 SKMGRTKS----------------------LKSAILDKLLPELFLDVMGCMMN--------SQKL 167

  Fly   198 LRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQ 262
            :.:|...|:.::..|::|..:.:|||:        ...|:.....:..:.|:|.|.:..|...|:
  Fly   168 VPVREGTCVGHYMPLIQDHGSRMGCGL--------RVKGRDEKESNIILLCHFSRASVNNLVPYE 224

  Fly   263 SGDRPATECRSGRNPVFINLCSVNEIYDSSNL 294
            .|..||.:|.:|.:.::..|||.:|..|::::
  Fly   225 EGQIPAGKCATGPSQMYQFLCSEDEYVDANSM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 37/187 (20%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 37/188 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440659
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.