DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crisp2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:236 Identity:47/236 - (19%)
Similarity:87/236 - (36%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILNELNEYRDRIARGDLMGFSP-ATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQ 130
            |:|:.||.|..:        :| .:.:..::|..:..:.|:....:|.|  :|....::..|:. 
Mouse    41 IVNKHNELRRSV--------NPTGSDILKMEWSIQATTNAQKWANKCIL--EHSSKDDRKINIR- 94

  Fly   131 VVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNN 195
                   .|:.|                  |.:.|..:.:|:.|.:....|..:..:.|  .||:
Mouse    95 -------CGENL------------------YMSTDPTLWSTVIQSWYNENEDFVYGVGA--KPNS 132

  Fly   196 RILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFV-RTNDV--N 257
                     .:.::||||..|:..:|||| ....|..|        :..:..|::. ..|:|  .
Mouse   133 ---------AVGHYTQLVWYSSFKIGCGI-AYCPNQDN--------LKYFYVCHYCPMGNNVMKK 179

  Fly   258 APVYQSGDRPATECRSG-RNPVFINLCSVNEIYDSSNLAGL 297
            :..||.| .|...|.:. .|.:..|.|...::.  ||...|
Mouse   180 STPYQQG-TPCASCPNNCENGLCTNSCDFEDLL--SNCESL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 34/183 (19%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 34/185 (18%)
Crisp 189..243 CDD:285731 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.