DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and scl-27

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:256 Identity:52/256 - (20%)
Similarity:89/256 - (34%) Gaps:91/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ADICSPDAH--IVRITTARRTMILNELNEYRDRIARGDLMGFS---PATRMATLQWDQELASFAE 106
            ||:...:|:  ||::.           ||..:.:|.|.....|   .|::|..::|:|.||. |.
 Worm    16 ADLYGKEAYDRIVKVH-----------NELGNDVACGKYQNHSDYPKASQMMMMKWNQSLAE-AV 68

  Fly   107 LNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKAT 171
            .|||.      .|:..:: |.:.:.:     :|:.|                             
 Worm    69 GNVKH------SCQQLKE-RYLKKFI-----KGENL----------------------------- 92

  Fly   172 LEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIA--------YFTQLVRDSTTHVGCGILRQT 228
                   |:......::......:.||| |..|.::        .|.:::.|..|.:||..    
 Worm    93 -------YRVYFYNTVVDGLQERDEILR-RSEKAVSTGANFEVERFHKILHDKVTSIGCSY---- 145

  Fly   229 KNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRP------ATECRSGRNPVFINLC 283
            ||..|:.|..:    :|..|.:...:  |..:|..|: |      .|.|....|..|.|||
 Worm   146 KNCENDQGYDM----RYFICKYSPID--NGDMYHVGE-PCSQCPVGTSCNQNANSEFFNLC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 36/196 (18%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 38/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.