DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and F57B7.2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:274 Identity:62/274 - (22%)
Similarity:97/274 - (35%) Gaps:72/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PERHIACNNFGALADICSPDAHIVRITTARRTMILNEL-NEYRDRI----------------ARG 81
            ||||...|  ||...:..| ...|.|..::.|.|:|.: |.|.|..                |:.
 Worm    65 PERHEHEN--GAAGGVPLP-TEPVPIPQSKSTNIVNNVSNSYGDDYEAVCSSIGEESRKNFDAQL 126

  Fly    82 DLMGFSPATRMATLQWDQELASFAELNVKR-CALVNDHCRNSEQFRNV--AQVVAE--GGW---- 137
            |.......|.:..:....:..:.:|:|.:| |...::.||......|:  :..:||  ..|    
 Worm   127 DKHMMQTITDVKYMIKHSKYTALSEVNFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKL 191

  Fly   138 --QGDPLPPSSPS-------DPPNPEAPIPVEYHTEDEVIKATLEQMFAEY-KECSMRDIIAFSP 192
              :|..|.|..|.       ...|.::.:|    |..|||:        |: ||....|   |..
 Worm   192 ADRGRVLYPELPGIGENLILKEANEQSHLP----TGQEVIQ--------EWEKEAQFFD---FDK 241

  Fly   193 PNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVN 257
            |...      .|| ..|:|:|...||.:|..   :..||.|..        ..:.|.:....:.|
 Worm   242 PRWN------PKC-QRFSQVVWKDTTELGAA---RYWNTANNC--------VAVVCFYRPAGNSN 288

  Fly   258 APVYQSGDRPATEC 271
            ||...:.:.|:.:|
 Worm   289 APGEFASNVPSRDC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 47/221 (21%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.