DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and scl-10

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_502498.1 Gene:scl-10 / 186049 WormBaseID:WBGene00009891 Length:212 Species:Caenorhabditis elegans


Alignment Length:264 Identity:52/264 - (19%)
Similarity:89/264 - (33%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLM 84
            |..|.:|: |||                          ..:...:..||:..|..|.:||.|..:
 Worm    10 LLIFSFCE-TLC--------------------------EFSETGKNYILSRHNYLRSQIALGKYV 47

  Fly    85 GFS----PATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPS 145
            ..:    .|:.|..|.||..|.:.|:.....|...:...|     .|:.:.:.  .|..      
 Worm    48 AGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASR-----ANIGENMY--WWTS------ 99

  Fly   146 SPSDPPNPEAPIPVEYHTEDEVI---KATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIA 207
                        ||...|:.|::   .|.|.:  :|::.        |....|.:.....:..|.
 Worm   100 ------------PVVTQTDAELLGNRSANLWE--SEFQR--------FGWNGNLLTEELFNSGIG 142

  Fly   208 YFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRPATECR 272
            :.||:...:|..:||||   :|.:::..|.....|..|....    |.:...:|:||: ..:.|.
 Worm   143 HATQMAWATTNKIGCGI---SKCSSDSFGTQYVVVCLYSPAG----NYIGMDIYKSGE-TCSNCP 199

  Fly   273 SGRN 276
            .|.|
 Worm   200 DGTN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 39/192 (20%)
scl-10NP_502498.1 SCP 25..179 CDD:214553 39/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.