DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and scl-8

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_502510.1 Gene:scl-8 / 183345 WormBaseID:WBGene00008030 Length:210 Species:Caenorhabditis elegans


Alignment Length:216 Identity:50/216 - (23%)
Similarity:81/216 - (37%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILNELNEYRDRIARGDLMG----FSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRN 127
            |||..|:.|.|||:|:.:.    ...||.|..::||..|...|:.....|     |.::|...:.
 Worm    26 ILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGC-----HMQHSTNDKT 85

  Fly   128 VAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSP 192
            :.:.: ...|.|||.   |..|.....|.:..::..|.                        |..
 Worm    86 IGENL-YWEWSGDPF---SDLDKFGKIATVAWDHEFEQ------------------------FGW 122

  Fly   193 PNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQ----SLSSVHQYMTCNFVRT 253
            .:|:......:..:|:.||:....|..:|||:    ||...:|.:    .::.|.||.    ||.
 Worm   123 NSNKFSLALFNTGVAHATQIAWAPTGKIGCGV----KNCGRDARRGGLFQVAIVCQYR----VRG 179

  Fly   254 NDVNAPVYQSGDRPATECRSG 274
            |.....:|.|| ...:.|.:|
 Worm   180 NFFFKNIYNSG-ATCSACPAG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 42/190 (22%)
scl-8NP_502510.1 SCP 22..175 CDD:214553 40/185 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.