DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and C07A4.3

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:206 Identity:41/206 - (19%)
Similarity:74/206 - (35%) Gaps:70/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGG 136
            |:||...:...:...|..|.:|. :|..|:|..     |:| ||::                :..
 Worm    53 NKYRAHHSSPAVTVDSNLTNLAQ-KWSDEMAFH-----KKC-LVHE----------------QPS 94

  Fly   137 WQGDPLPPSSPSDPPNPE---APIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRIL 198
            ..|:.|...:.|..|:|:   |.:...::||......|                 .|:|.:    
 Worm    95 KYGENLTSFASSKFPSPKTCAAALIHGFYTEGYGFNYT-----------------RFNPGS---- 138

  Fly   199 RLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF-----VRTND--- 255
               .|| :.:||||:..::..:|.|:....:.|         ..|.|:...:     ::|::   
 Worm   139 ---WSK-VGHFTQLLWKNSRKIGVGVSVAKRGT---------MYHVYVCIKYDPPGNMQTSEAYM 190

  Fly   256 --VNAPVYQSG 264
              |.||...||
 Worm   191 DNVRAPKSTSG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 35/180 (19%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 35/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.