DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and C07A4.2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:239 Identity:44/239 - (18%)
Similarity:74/239 - (30%) Gaps:71/239 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNS 122
            :|.|.....|...:.||.. |.|.::.|..  .:....|:....::|.|.|.|            
 Worm    23 QIPTTDAKSITVSVKEYTG-IRRNEIRGVE--NQFYYFQFCTCPSTFTERNFK------------ 72

  Fly   123 EQFRNVAQVVAEGGWQGDPLPPSSP-----SDPPNPEAPIPVEYHTEDE-----VIKATLEQMFA 177
                 |::.|.....:|..|..|.|     |...|......:....::|     .:|..:.....
 Worm    73 -----VSECVCSDAQKGKKLDDSIPQAKFFSSSRNCGTGFCINAKIDNEQGEKLFVKVFIGSTVL 132

  Fly   178 EYKECSMRDIIAFSPPNNRILRLRVSKCIA-------------YFTQLVRDST-------THVGC 222
            .|             |:.::|..|.:|.:|             |.|:...|.|       ||...
 Worm   133 TY-------------PDYQVLPARSTKSVAILKTNKSSKIRLTYSTETDDDGTSKTAIEKTHWSN 184

  Fly   223 GILRQTK--------NTTNEAGQSLSSVHQYMTCNFVRTNDVNA 258
            .|||.::        ..||:....|.|....:..:..|.:::.|
 Worm   185 TILRDSRGGALDFFSRLTNQKKYDLKSASVPLDTDVKRLSNIGA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 40/223 (18%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.