DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and vap-2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:284 Identity:64/284 - (22%)
Similarity:105/284 - (36%) Gaps:92/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCPGPER------HIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIAR-----GDL 83
            ||..|..      ...|:| ..::|:             .|...|.:.|.||.|:|:     |:.
 Worm   290 LCQAPSMVKDDGGSFQCDN-SLVSDV-------------TRNFTLEQHNFYRSRLAKGFEWNGET 340

  Fly    84 MGFSP-ATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSP 147
            ....| |::|..:::|..|..||:.....|...  |..:.|:..           ||..|..||.
 Worm   341 NTSQPKASQMIKMEYDCMLERFAQNWANNCVFA--HSAHYERPN-----------QGQNLYMSSF 392

  Fly   148 SDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRV----SKCIAY 208
            |: |:|.:.|    ||       .:|:.:.|.:|        |..|.:.:|...:    .|.|.:
 Worm   393 SN-PDPRSLI----HT-------AVEKWWQELEE--------FGTPIDNVLTPELWDLKGKAIGH 437

  Fly   209 FTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF-VRTNDVNAPVYQSGDRP----- 267
            :||:..|.|..:||||....|.:             |:.|:: ...|..|..:|:.|| |     
 Worm   438 YTQMAWDRTYRLGCGIANCPKMS-------------YVVCHYGPAGNRKNNKIYEIGD-PCEVDD 488

  Fly   268 ----ATECRSGRNPVFINLCSVNE 287
                .|:|..     ..:||.:::
 Worm   489 DCPIGTDCEK-----TTSLCVISK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 48/195 (25%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 48/198 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.