DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crispld2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:310 Identity:67/310 - (21%)
Similarity:110/310 - (35%) Gaps:107/310 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELN 72
            |:.|.|::.|  :|||      ..|         |..:|..:.|...|....:..||.:.:::..
  Rat    10 PVGLALLVCG--VQAF------FLP---------NTMSLERLLSKYQHTEPHSRVRRAIPMSDRQ 57

  Fly    73 E---YRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAE 134
            |   ..::: ||.:  :.||:.|..:.||:||...|....:||.                     
  Rat    58 EILMLHNKL-RGQV--YPPASNMEYMTWDEELERSAAAWAQRCL--------------------- 98

  Fly   135 GGWQGDPLPPSSPSDPPNPEAPIPVE----------------YHTE---DEVIKATLEQMFAEYK 180
              |:..|             |.:.|.                :|.:   |||...|    :....
  Rat    99 --WEHGP-------------ASLLVSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYT----YPYPH 144

  Fly   181 ECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQY 245
            ||:     .:.|.     |...:.| .::||:|..:|..:||.:  .|..:.:..|....:. .|
  Rat   145 ECN-----PWCPE-----RCSGAMC-THYTQMVWATTNKIGCAV--HTCRSMSVWGDIWENA-VY 195

  Fly   246 MTCNF-VRTNDVNAPVYQSGDRPATECRSG-----RNPVFINLCSVNEIY 289
            :.||: .:.|.:....|:.| ||.:||.|.     ||    |||...|.|
  Rat   196 LVCNYSPKGNWIGEAPYKHG-RPCSECPSSYGGGCRN----NLCYREEHY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 38/207 (18%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 38/201 (19%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.