DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CG43777

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:300 Identity:78/300 - (26%)
Similarity:123/300 - (41%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLMLLGQQLQAFDYCDPTL--CP-GPERHIACNNFGALADIC----SPDAHIVRITTARRTM 66
            |||.::||......::||:...  |. ..::|..|:    |.|..    |...|.......|...
  Fly     5 LLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCH----LKDFTVYGNSTKFHASVPNNMRMQK 65

  Fly    67 I-LNELNEYRDRIARGDL-----MGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQF 125
            | |:.||..|::.|.|:|     ..|:.|.||..|.||:|||.....:....:|.:..||::.:|
  Fly    66 IALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRSTLRF 130

  Fly   126 RNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDII-- 188
            .:|.:.:|                     ...|.|.....|:.......|||||:..|..|.:  
  Fly   131 PHVGEAIA---------------------LVTPREKLNLKEIYSKAFTPMFAEYQHVSDPDALLH 174

  Fly   189 AFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRT 253
            ||.|  :|..::|      :||.::.|..:.||||:.     .......|:...| ::||.|...
  Fly   175 AFDP--DRDFQVR------HFTNIISDRVSRVGCGVA-----VGANCNPSIKFCH-FLTCYFDFH 225

  Fly   254 NDVNAPVYQSGDRPATECRSG---RNPVFINLC-SVNEIY 289
            |...:.||::|| |.:.|...   .:..:.||| :..||:
  Fly   226 NMAGSYVYKAGD-PTSSCDDWGVVSSDKYANLCKNSGEIF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 50/193 (26%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 50/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440663
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.