DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:280 Identity:59/280 - (21%)
Similarity:85/280 - (30%) Gaps:92/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYR 75
            |.|:|||..|.|      ...|..|.....|.:                        :|..||.|
Human    31 LWLLLLGSSLNA------RFLPDEEDVDFINEY------------------------VNLHNELR 65

  Fly    76 -DRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALV-NDHCRNSEQFRNVAQVVAEGGWQ 138
             |.|.||..:.|        :.||..|:..|....|:|... |.:.::.:........:.|..|.
Human    66 GDVIPRGSNLRF--------MTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWV 122

  Fly   139 GDPLPPSSPSDPPNP-EAPIPV-EYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLR 201
            |          |.|. .|.|.: .:|.|.::..       .|...||                  
Human   123 G----------PENEFTASIAIRSWHAEKKMYN-------FENGSCS------------------ 152

  Fly   202 VSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDR 266
             ..|..|. |||.|.:..|||.:     ...::.|..:.:.  ...||:.....:....|:    
Human   153 -GDCSNYI-QLVWDHSYKVGCAV-----TPCSKIGHIIHAA--IFICNYAPGGTLTRRPYE---- 204

  Fly   267 PATEC-RSGRNPVFIN-LCS 284
            |...| |.||.....: |||
Human   205 PGIFCTRCGRRDKCTDFLCS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 39/189 (21%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 41/218 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.