DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crisp1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:240 Identity:38/240 - (15%)
Similarity:84/240 - (35%) Gaps:88/240 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SPDAHIVRITTARRTM---ILNELNEYRDRIARGDLMGFSPA-TRMATLQWDQELASFAELNVKR 111
            |.:..:.:::|.:.::   |:::.|:.|..:        ||: :.:..::|:.:    |::|.::
Mouse    23 SQENRLEKLSTTKMSVQEEIVSKHNQLRRMV--------SPSGSDLLKMEWNYD----AQVNAQQ 75

  Fly   112 CALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTED----EVI---- 168
            .|   |.|..|..                                 |:|..|.:    |.:    
Mouse    76 WA---DKCTFSHS---------------------------------PIELRTTNLRCGENLFMSS 104

  Fly   169 -----KATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQT 228
                 .:.::..:.|||:.:. |:....|          ...:.::||:|.:||..|.||:....
Mouse   105 YLASWSSAIQGWYNEYKDLTY-DVGPKQP----------DSVVGHYTQVVWNSTFQVACGVAECP 158

  Fly   229 KNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVY--QSGDRPATEC 271
            ||          .:..|..|::....:....:|  .:...|...|
Mouse   159 KN----------PLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASC 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 33/202 (16%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 33/203 (16%)
Crisp 190..244 CDD:285731 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.