DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and glipr1a

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:221 Identity:44/221 - (19%)
Similarity:70/221 - (31%) Gaps:51/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNELNEYRDRIARGDLMGFSP-ATRMATLQWDQELASFAELNVKRCALV-NDHCRNSEQFRNVAQ 130
            :.|.|:.|..:        || |..|..:.||..||..|....:.|... |.|.|.:::......
Zfish    36 VREHNQNRSSV--------SPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFT 92

  Fly   131 VVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNN 195
            .|.|..|.|.|....:                     :|:.:.....|.|:        ::..||
Zfish    93 TVGENIWAGAPYSRFT---------------------VKSAVFSWVNELKD--------YNYNNN 128

  Fly   196 RILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRT-NDVNAP 259
               :....|...::||:|...:..|||.:.............::..|  ...||:... |.....
Zfish   129 ---QCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGV--IFVCNYATAGNFAGRS 188

  Fly   260 VYQSGDRPATECR--SGRNPVFINLC 283
            .|:.|    ..|.  .|.:....|||
Zfish   189 PYKQG----ASCSGCGGSDKCERNLC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 35/183 (19%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.