DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CRISP3

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:305 Identity:59/305 - (19%)
Similarity:97/305 - (31%) Gaps:98/305 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKWPPLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTM-- 66
            |.:|.||.|:..|.....|.:..||.             |.||            :||..:..  
Human    33 TLFPVLLFLVAGLLPSFPANEDKDPA-------------FTAL------------LTTQTQVQRE 72

  Fly    67 ILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRC----ALVNDHCRNSEQFRN 127
            |:|:.||.|..::       .||..|..::|::|.|:.|:....:|    :...|...:.:...|
Human    73 IVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGEN 130

  Fly   128 VAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSP 192
            :....|...|                               ...::..|.||.:....  :....
Human   131 LYMSSASSSW-------------------------------SQAIQSWFDEYNDFDFG--VGPKT 162

  Fly   193 PNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVR----T 253
            ||         ..:.::||:|..|:..||||         |....:...:..|..|.:..    .
Human   163 PN---------AVVGHYTQVVWYSSYLVGCG---------NAYCPNQKVLKYYYVCQYCPAGNWA 209

  Fly   254 NDVNAPVYQSGDRPATECRSG-RNPVFINLCSVNEIYDSSNLAGL 297
            |.:..| |:.| .|...|... .:.:..|.|...::|  ||...|
Human   210 NRLYVP-YEQG-APCASCPDNCDDGLCTNGCKYEDLY--SNCKSL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 33/191 (17%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151344
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.