DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and r3hdml

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:243 Identity:53/243 - (21%)
Similarity:88/243 - (36%) Gaps:92/243 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRN---------- 121
            :|:..|:.|.::       |.||..|..:.||:.||..||....:|..  ||..|          
 Frog    66 LLDYHNQVRSKV-------FPPAANMEYMVWDERLAKSAESWANQCKW--DHGPNQLMRYIGQNL 121

  Fly   122 ---SEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECS 183
               |.::|::..:|.  ||..:....|.    |:|                          :||:
 Frog   122 SVHSGRYRSIVDLVK--GWYDERQHYSF----PHP--------------------------RECN 154

  Fly   184 MRDIIAFSPPNNRILRLRVSKC----IAYFTQLVRDSTTHVGCGI-----LRQTKNTTNEAGQSL 239
            .      |.||         ||    ..::||:|..|:..:||.:     :....:|..:|    
 Frog   155 P------SCPN---------KCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQA---- 200

  Fly   240 SSVHQYMTCNF-VRTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVN 286
                .|:.||: ::.|.:....|:.| ||.:.|    .|.:..:||.|
 Frog   201 ----SYLVCNYSIKGNWIGEAPYKLG-RPCSAC----PPSYGGVCSNN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 42/204 (21%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 43/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.