DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and LOC100490275

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:224 Identity:45/224 - (20%)
Similarity:71/224 - (31%) Gaps:84/224 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 W-PPLLLLLMLLG-QQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMIL 68
            | |.|:|::.:.| :||      |||.....||.:                          |.::
 Frog     2 WLPQLMLVVSVCGARQL------DPTPAYNNERFV--------------------------TDLV 34

  Fly    69 NELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVA 133
            |..|:.|:...:       .|..|..:.||..||..|:.....|..|.:...|.|......:.:.
 Frog    35 NAHNDIRNEFGK-------QAANMLHMSWDVGLAKLAQAWTINCKKVPNPHLNKESIYPRFKQIG 92

  Fly   134 EGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKAT----LEQMFAEYKECSMRDIIAFSPPN 194
            |..:.|..:                       ::.|..    ||..|.:.|..|.:.        
 Frog    93 ENLYMGPSI-----------------------DIFKIVTNWGLEGNFYDLKNNSCQP-------- 126

  Fly   195 NRILRLRVSKCIAYFTQLVRDSTTHVGCG 223
                    .|..::|||:|..:|..||||
 Frog   127 --------GKDCSHFTQIVWANTYKVGCG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 33/164 (20%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 34/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.