DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and crisp1.6

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_002933627.1 Gene:crisp1.6 / 100379939 XenbaseID:XB-GENE-5838744 Length:237 Species:Xenopus tropicalis


Alignment Length:250 Identity:49/250 - (19%)
Similarity:81/250 - (32%) Gaps:94/250 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TTARRTMILNELNEYRDRIARGDLMGFSPATR-MATLQWDQELASFAELNVKRCALVNDHCRNSE 123
            |:..:.:|::..|.||..:        :|:.| |..:.|.:..||.|......|...  |...|:
 Frog    30 TSTVQQVIVDTHNGYRRSV--------NPSARNMLKMMWSEAAASNAATWSATCPAA--HSPTSQ 84

  Fly   124 QFRNVAQVVA---------EGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKA-TLEQMFAE 178
              |.::.|..         ...||                           |.|.| ..|..:.:
 Frog    85 --RTISGVTCGENIFIASYPASWQ---------------------------EAITAWNSESQYFQ 120

  Fly   179 YKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVH 243
            |         ...|.::       ::...::||||..::..|||.:    .|..|          
 Frog   121 Y---------GVGPTSS-------NQVTGHYTQLVWYNSYMVGCAV----SNCNN---------- 155

  Fly   244 QYM-TCNFV----RTNDVNAPVYQS----GDRPATECRSGRNPVFINLCSVNEIY 289
            ||: .|.:.    ..|.:..| |:|    ||.|.. |.:|   :..|.|...::|
 Frog   156 QYIYVCQYCPMGNNLNTITTP-YKSGPACGDCPGA-CDNG---LCTNPCPYQDMY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 36/197 (18%)
crisp1.6XP_002933627.1 CAP_CRISP 32..166 CDD:349402 36/202 (18%)
Crisp 183..236 CDD:369954 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.