DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and XB5812873

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:295 Identity:53/295 - (17%)
Similarity:93/295 - (31%) Gaps:88/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YCDPTLCPGPERHIACNNF---GALADICSPDAHIVRITT---------ARRTMILNELNEYRDR 77
            ||.|.........:..|.|   ..||.:..|.:....:.:         :.|..|:::.|.||..
 Frog    16 YCIPRSFHNLSSFLEMNGFLLLLCLASLSKPTSEQDSVESFDEMSTDLESNRNFIVDKHNYYRSW 80

  Fly    78 IARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPL 142
            :.       .||..|..:.||    ::.....|..||......::..||...     |.:.|:.:
 Frog    81 VN-------PPAADMLKMHWD----NYYLAKAKEWALTCSFKHSNLSFRQYG-----GEFAGENI 129

  Fly   143 PPSSPSDPPNPEAPIPVEY--HTEDEVIKATL-EQMFAEYKECSMRDIIAFSPPNNRILRLRVSK 204
            ..|               |  |:.:.||.... |.:..||...:.::                ..
 Frog   130 MNS---------------YFRHSWEYVINYWFNEHVNWEYAVGTTKE----------------GA 163

  Fly   205 CIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFV----RTNDVNAPVYQSGD 265
            ...:|||::...|..:.|.:.:......|          .:..|.:.    |.:.|..| ||:| 
 Frog   164 VTGHFTQIIWAPTHALACYVAKCYGTPYN----------YFYVCIYYPTGNREDKVKTP-YQNG- 216

  Fly   266 RPATEC----RSGRNPVFINLCSVNEIYDSSNLAG 296
               |.|    :...:.:.:|.|   ..|:|:...|
 Frog   217 ---TTCGLCQKDCDDQLCLNYC---PYYNSAGNCG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 32/188 (17%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 32/192 (17%)
Crisp 219..269 CDD:400739 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.