DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and R3hdml

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:287 Identity:62/287 - (21%)
Similarity:110/287 - (38%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRD 76
            ||:.:|..:.|....:.||..|..::.|   ...|:.:..|.....|..:||.   ::.|.:|.:
Mouse    13 LLLWMGHTVGALRMPNTTLVQGRPKNTA---VWPLSGLGVPRHRRKRHISARD---MSALLDYHN 71

  Fly    77 RIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCR-----------NSEQFRNVAQ 130
            .| |..:  ..||..|..:.||::||..||....:|...:...:           :|.:||:|..
Mouse    72 HI-RASV--HPPAANMEYMVWDEQLARSAEAWATQCIWTHGPSQLMKYVGQNLSIHSGRFRSVVD 133

  Fly   131 VVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNN 195
            :|.  .|..:....|.|       ||                       |:|:.......|.|  
Mouse   134 LVR--SWSEEKRHYSFP-------AP-----------------------KDCTPHCPWLCSGP-- 164

  Fly   196 RILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF-VRTNDVNAP 259
                     ..:::||:|..|::.:||.|  .|.::.|..|.:.... .|:.||: ::.|.:...
Mouse   165 ---------VCSHYTQMVWASSSRLGCAI--NTCSSINVWGNTWQQA-VYLVCNYAIKGNWIGEA 217

  Fly   260 VYQSGDRPATECRSGRNPVFINLCSVN 286
            .|::| :|.:.|    .|.:...|:.|
Mouse   218 PYKAG-KPCSAC----PPSYQGNCNSN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 40/196 (20%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 41/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.