DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or19a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:391 Identity:74/391 - (18%)
Similarity:153/391 - (39%) Gaps:75/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWALLYDKNLRRYVCIGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHD 81
            ||.    ::...|..:...:|||...:.:.::..:.      ||      :.|...:..:...|.
  Fly    32 FWG----RHYTAYSMVWNVTFHICIWVSFSVNLLQS------NS------LETFCESLCVTMPHT 80

  Fly    82 RYLALIQKLTEAYYDLLN--------LNDSYISEILDQVNKVG-----KLMARG---------NL 124
            .|:          ..|:|        ::..::..:||:  ::|     :::..|         .:
  Fly    81 LYM----------LKLINVRRMRGQMISSHWLLRLLDK--RLGCDDERQIIMAGIERAEFIFRTI 133

  Fly   125 FFGMLTSMGFG-LYPLSSSERVLPFGSKIP-GLNEYESPYYEMWYIFQMLITPM-GCCMYIPYTS 186
            |.|:..::..| :|..:|||..|.:.:.|| ...:..|.|         |.|.| .....:...:
  Fly   134 FRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAY---------LATAMLHTTALMANAT 189

  Fly   187 LIVGL-------IMFGIVRCKALQHRLRQVALKHPYGDRDPR-ELREEIIACIRYQQSIIEYMDH 243
            |::.|       ::...|..|||..|:.::.    ||...|. .::..::..|...|.|:.....
  Fly   190 LVLNLSSYPGTYLILVSVHTKALALRVSKLG----YGAPLPAVRMQAILVGYIHDHQIILRLFKS 250

  Fly   244 INELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELR-EQN 307
            :....:|....:..:.:...|.:.:.|:..:......:..:::.:||.....|..|..||. ::.
  Fly   251 LERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEG 315

  Fly   308 LAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKR 372
            .::.||.|...|.:..|..|:.:|.|:.|.|.|..::.|.|.||:::.|..::...||..|:|..
  Fly   316 ESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380

  Fly   373 V 373
            :
  Fly   381 I 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 64/344 (19%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 63/337 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.