DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or98b

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:392 Identity:77/392 - (19%)
Similarity:145/392 - (36%) Gaps:72/392 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLYDKNL-RRY----VC--IGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLL 77
            ||::::: .||    :|  :.:|||...| |.:      ||.. ::|...|...:.:||...|.|
  Fly    21 LLHEQDVGHRYPWRSICCILSVASFMPLT-IAF------GLQN-VQNVEQLTDSLCSVLVDLLAL 77

  Fly    78 ADHDRYLALIQK---LTEAYYDLLNL-NDSYISEIL-------DQVNKVGKLMARGNLFFGMLTS 131
            .....:|.|.:.   |...:|.:|.. ..:.::|::       ||.  :..:.|...:..|:...
  Fly    78 CKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQF--ISAMYAYCFITAGLSAC 140

  Fly   132 MGFGLYPLSSSERV------LPFGSKIP----GLNEYESPYYEMWYIFQML-ITPMGCCMYIPYT 185
            :...|..|.|.:|.      .||.|..|    .|:.|...|:  |.:...| :.....|:...:.
  Fly   141 LMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISYF--WNVCAALGVALPTVCVDTLFC 203

  Fly   186 SLIVGL-IMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEI-------IACIRYQQSIIEYMD 242
            ||...| .:|.|.|.|.:.           :..|:.:|..|.:       ..|:.....:.||..
  Fly   204 SLSHNLCALFQIARHKMMH-----------FEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFR 257

  Fly   243 HINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQN 307
            .:        :.:.:|.|..||.|.:.|........|:....:...::.|:....:..:.:..:.
  Fly   258 PL--------ICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSEC 314

  Fly   308 LAVATAAYETEW---FTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTV 369
            .....|.||:.|   ...::.|..::...|||:.....| .|.......|....::.|..::.|:
  Fly   315 QLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPI-DGYFFEANRETLITIVRTAISYVTL 378

  Fly   370 LK 371
            |:
  Fly   379 LR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 64/343 (19%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 62/336 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.