DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or98a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:370 Identity:72/370 - (19%)
Similarity:145/370 - (39%) Gaps:65/370 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QLIYMNIKILRF-WALLYDKNLRRYVCIGL-----ASFHIFT--QIVYMMSTNEGLTGIIRNSYM 62
            ::||.....|.| |..:       |:.||:     ...:.||  :::.:|.......|:......
  Fly    40 KIIYYITSCLIFAWCAV-------YLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLF 97

  Fly    63 LVLWINTVLRAYLLLADHDRYLALIQKLTEAYYDLLNLNDSYISEILDQVNKVGKLMARGNLFFG 127
            ..|:|:...:|..||::.|:....:::..|.:..::..|.:|:                  ::..
  Fly    98 FNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYL------------------IYQF 144

  Fly   128 MLTSMGFGLYPLSSSERVLPFGSKIP--GLNEYESPYYE---------MWYIFQMLITPMGCCMY 181
            :.|:.....:..::....||:....|  ...|..|.:::         ::.:.|.|::.:     
  Fly   145 IYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDI----- 204

  Fly   182 IPYTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINE 246
               ..|:.|||:  .|..|.|  |||..:|....|..| .|..:::|.||:....||:|...|..
  Fly   205 ---YPLLYGLIL--RVHLKLL--RLRVESLCTDSGKSD-AENEQDLIKCIKDHNLIIDYAAAIRP 261

  Fly   247 LTT----MMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQN 307
            ..|    :.||...:.....:..|||...|.:|    :....|||.::.|.....:..:.|::..
  Fly   262 AVTRTIFVQFLLIGICLGLSMINLLFFADIWTG----LATVAYINGLMVQTFPFCFVCDLLKKDC 322

  Fly   308 LAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPIT 352
            ..:.:|.:.:.|.......:.::.:.:..||:..|...|:|.||:
  Fly   323 ELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPIS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 61/315 (19%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 63/329 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.