DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or94a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:380 Identity:79/380 - (20%)
Similarity:146/380 - (38%) Gaps:91/380 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TGIIRNSYMLVL------------WINTVLRAYLLLADHDRY-----LALIQKL-------TEAY 94
            ||.::.:|..:|            |:...:.:.|..|....|     :||:.|:       |||:
  Fly    37 TGFVKRNYRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYRTEAW 101

  Fly    95 ---YDLLNLNDSYISEILDQVNKVGKLMARGNLFFG------MLTSMGF------GLYPLSSSER 144
               |:|.:..| |.....::|:    ...|...||.      :|.|:|.      |:..|...| 
  Fly   102 RLMYELQHAPD-YQLHNQEEVD----FWRREQRFFKWFFYIYILISLGVVYSGCTGVLFLEGYE- 160

  Fly   145 VLPFGSKIPGLNEYESPYYEMW--YIFQMLITPMGC----------CMYIPYTSLIVGLIMFGIV 197
             |||...:|...:.|..|   |  |.:.|....:.|          |.::.:.||:..|:...:.
  Fly   161 -LPFAYYVPFEWQNERRY---WFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRLLGLRLR 221

  Fly   198 RCKALQH------RLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFEL 256
            ..|.:::      :||.:.:.|       :.:|...:.|   |:.:..|:           |.::
  Fly   222 ETKNMKNDTIFGQQLRAIFIMH-------QRIRSLTLTC---QRIVSPYI-----------LSQI 265

  Fly   257 MAFSALLCALLFMLI---IVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETE 318
            :..:.::|...:.|.   |.....|.|.:..::::::.||....:|.||:......:....|.|.
  Fly   266 ILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTN 330

  Fly   319 WFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV 373
            |.....|:||.:...|...::|..|..||...:.|.:|...:|..|:|..:|..|
  Fly   331 WLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLNV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 75/369 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 70/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.