DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or88a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:104/247 - (42%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PLSSSERVLPFGSKIP-GLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRCKA 201
            |::..|::|  |..:| |:.:..:.|..:| .|.::.|..|...::.:.:|      |.:::...
  Fly   170 PVAQHEQLL--GGWLPCGVRKDPNFYLLVW-SFDLMCTTCGVSFFVTFDNL------FNVMQGHL 225

  Fly   202 LQHRLRQVALKHPYGDRDPRE-LREE------IIACIRYQQSIIEYMDHINELTTMMFLFELMAF 259
            :.| |..:|  ..:...|||: |.:|      :...::.||.:.......|::..:.||......
  Fly   226 VMH-LGHLA--RQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVG 287

  Fly   260 SALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYET-----EW 319
            :..||..||||   |.||.::|:..||...|  :|..:.:...||...|..|:...|:     ||
  Fly   288 AGSLCFYLFML---SETSDVLIIAQYILPTL--VLVGFTFEICLRGTQLEKASEGLESSLRSQEW 347

  Fly   320 FTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLK 371
            :......||..|......||...:....:..:.:..|..::...|..||.||
  Fly   348 YLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 53/238 (22%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.