DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or85f

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:420 Identity:86/420 - (20%)
Similarity:173/420 - (41%) Gaps:80/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDIQLIYMNIKILR---FWALLYD------KNLRRY--------------VCIGLASFHIF---- 40
            |.:|..|.:...|.   ||.:.||      ...||.              ||:|:..|.:.    
  Fly     2 EPVQYSYEDFARLPTTVFWIMGYDMLGVPKTRSRRILYWIYRFLCLASHGVCVGVMVFRMVEAKT 66

  Fly    41 -----------TQIVYMMSTNEGLTGIIR-------NSYMLVLWINTVL-RAYLLLADHDRYLAL 86
                       |.:.|:::::.....:::       ||.:..|:..|.| |.|..:.||      
  Fly    67 IDNVSLIMRYATLVTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYHRVNDH------ 125

  Fly    87 IQKLTEAYYDLLNLNDSYISEILDQVNKVGKLMARGNLFF--GMLTSMGFGLYPLSSSERVLPFG 149
              ..|:::..|:.:   ||...:..|  :|.::.....:|  .:.|.|....|.|...|      
  Fly   126 --YWTKSFVYLVII---YIGSSIMVV--IGPIITSIIAYFTHNVFTYMHCYPYFLYDPE------ 177

  Fly   150 SKIPGLNEYESPYYEMW-YIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRCKALQHRLRQVALKH 213
             |.| :..|.|.|...| :..||:|:.:|..:::.|..:.:.|...||:|..| .|:   .::||
  Fly   178 -KDP-VWIYISIYALEWLHSTQMVISNIGADIWLLYFQVQINLHFRGIIRSLA-DHK---PSVKH 236

  Fly   214 PYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQ 278
            ...|      |:.|...:..|..::...:.:|.:.....|..|:..:|::|.:....:|...|.:
  Fly   237 DQED------RKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQGPTLE 295

  Fly   279 LIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAI 343
            .....::|...:.|:..:.:|..::.:.:..||.|.|..::....:..::.:|.:::|||:|..:
  Fly   296 GFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVEL 360

  Fly   344 LLGNIRPITLELFQNLLNTTYTFFTVLKRV 373
            .......|:|:.|:.|::.:|...|:|.::
  Fly   361 NAMGYLSISLDTFKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 67/321 (21%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 69/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.