DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or83a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:434 Identity:76/434 - (17%)
Similarity:168/434 - (38%) Gaps:106/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILRFWALLYDKNLRRYVCIGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLA 78
            ::||..|.|:. ...:|.:.:|..:|.|  :|:   |.|...       |..::|.:::..:.| 
  Fly    48 LVRFCDLTYEL-FNYFVSVHIAGLYICT--IYI---NYGQGD-------LDFFVNCLIQTIIYL- 98

  Fly    79 DHDRYLALIQKLTEAYYD----------LLNLNDSYISEILDQVN----------KVGKLMARGN 123
                 ..:..||   |:.          |.|:||.|  |....|.          ::.||..:..
  Fly    99 -----WTIAMKL---YFRRFRPGLLNTILSNINDEY--ETRSAVGFSFVTMAGSYRMSKLWIKTY 153

  Fly   124 LFFGMLTSMGFGLYPLSSSERVLPFGSKIPGLNEYESP-YYEMWYIFQMLITPMG---------- 177
            ::...:.::.:...|::..:|.||.....|  .:|..| .||:.::.|    .||          
  Fly   154 VYCCYIGTIFWLALPIAYRDRSLPLACWYP--FDYTQPGVYEVVFLLQ----AMGQIQVAASFAS 212

  Fly   178 -------CCMYI--PYTSLIVGL---IMFGIVRCKALQHRLRQVALKHPYGDRDP---------- 220
                   .|:.|  .|..|...|   :....|...|....|.|:..:....|.:|          
  Fly   213 SSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEE 277

  Fly   221 ---REL-------------REEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFM 269
               :||             |...:.||::.:.|:..:..|....:.::..::...:.|:|.:.| 
  Fly   278 TPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAF- 341

  Fly   270 LIIVSGTS-----QLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPLRKN 329
             :....|:     :::.:..|:.::|.::..:.::|:.:.:.:.....|.:.:.|......:|.:
  Fly   342 -VSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSD 405

  Fly   330 ILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV 373
            .:|.|:.::|...:..|.|..:.::.|:..:.|.::|.|:|:::
  Fly   406 YMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQKM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 62/384 (16%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 47/292 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.