DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or63a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:420 Identity:93/420 - (22%)
Similarity:151/420 - (35%) Gaps:101/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KILRFW---------ALLYD--KNLRRYVCIGLASFHIFTQIVYMMSTN-EGLTGIIRNSYMLVL 65
            ::||.|         |.||.  :.|.||:       |...:|.....|. :.||.|.:      :
  Fly    40 QVLRIWTIVLSVSSLASLYGHWQMLARYI-------HDIPRIGETAGTALQFLTSIAK------M 91

  Fly    66 WINTVLRAYLLLADHDRY--------LALIQK--LTEAYYDLLNLNDSYISEILDQV----NKVG 116
            |       |.|.|....|        ..|:||  |.|...||     ..|.||..||    |:..
  Fly    92 W-------YFLFAHRQIYELLRKARCHELLQKCELFERMSDL-----PVIKEIRQQVESTMNRYW 144

  Fly   117 KLMARGNLFF----------GMLTSMGFGLY-----PLSSSERVLPFGSKIP-----GLNEYESP 161
            ....|..|.:          ..:.|....||     |..|.:.:||..|..|     ||   |.|
  Fly   145 ASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGL---EFP 206

  Fly   162 YYEMWYIFQMLITPMGCCMYI------PYTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDP 220
            ||.:    ||.:..  |.:||      .:..:.:.|.:..:...::|...:.|..     .:..|
  Fly   207 YYHI----QMYLET--CSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQAT-----SELVP 260

  Fly   221 RELREEIIACIRYQ-QSIIEYMDHIN----ELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLI 280
            .:.|.|.:.|..|| |.:..:...:|    .:|...||..|..:.   .||..|.:.:...|.:.
  Fly   261 PDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWG---LALFQMSVGLGNNSSIT 322

  Fly   281 IVCMYINMILA--QILALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAI 343
            ::.|.:.::.|  ||:...:........:..:|.|.|:..|:......|..|..|:||..|...:
  Fly   323 MIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRL 387

  Fly   344 LLGNIRPITLELFQNLLNTTYTFFTVLKRV 373
            .:.....::|.....::.|:..:|.:|:.|
  Fly   388 DVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 78/357 (22%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 79/366 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.